Spectramax 384. Wavelength Selection: Monochromator, tunable 1. Spectramax 384

 
 Wavelength Selection: Monochromator, tunable 1Spectramax 384  These models can no longer be repaired

4. o SpectraMax M2 - Absorbance spectrum wavelength value change problem has been fixed. Both the SpectraMax M5 and the Gemini EM are monochromator-based, microplate readers. The SpectraMax M2e are multidetection microplate readers with dual-monochromators, dual-mode cuvette ports, and top- and bottom-reading capability. Open the catalog to page 2. For more sample throughput, the system can be. Note: for SpectraMax microplate readers without a cuvette port, the water constant is automatically used in PathCheck calculations, and no Water Constant option appears in the Instrument Settings. Reads standard cuvettes & 96-384 well plates from 190 to 1000 nm. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. The SpectraMax 384 Plus lets you get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Model is Spectramax Plus 384. The SpectraMax M4 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96 and 384-well microplates. With optimized reagents, option to operate the. Data of selected analytes in the graphs below illustrate sample correlations between 96-well and 384-well format of 16 human plasma samples. Insert the snorkel into the bottle and then insert the snorkel into the snorkel clamp. The microplates were read the next day from the bottom and the top in SpectraMax M5 and Gemini EM readers. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Assay Performance with Various Instrument Settings The SpectraMax® M2/M2e instruments use SoftMaxPro® DataSpectraMax® Microplate Readers and SoftMax® Pro Software. Description 1. The optical performance is comparable to a top-of-the-line dedicatedDescription Microplates The SpectraMax Multi-Mode Microplate Reader can accommodate SBS- standard 6-well to 384-well microplates and strip wells. , FI 45 sec. Customize data collection and analysis. SpectraMaxi3xMulti-ModeDetectionPlatformUserGuide 26 5039228DOther things to consider include plate format – 96-well and 384-well plates are the norm but higher and lower capacity plate sizes are also available, speed and throughput needed, type of software, and whether or not multiple plates or wells can be read simultaneously. SpectraMax® Gemini™ EM Microplate Reader, Molecular Devices. Check the optical alignment, you will have to disassemble and remove optical cover. Molecular Devices Spectramax 384 Plus Microplate Reader is available from The Lab World Group. With optimized reagents and the industry-leading data acquisition and analysis tool, SoftMax Pro® 7 Software, the SpectraMax® iD3. Molecular Devices UVmax Kinetic Microplate Reader. Avantor is setting science in motion for a better world | Avantor - VWROverview of 384-Well High Sample Recovery Plate. Applications. Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. The SpectraMax M5e Multi-Mode Microplate Reader features a triple-mode cuvette port, temperature control, microplate shaking, and the industry leading SoftMax Pro. dual monochRomatoRs foR assay flexibility With SpectraMax Multi-Mode Readers, there is no need to utilize expensive filters to optimize detection levels and background. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselected wavelengthsinasinglereadmode. Products : FlexStation 3 reader, SpectraMax M5/M5e reader, SpectraMax M2/M2e reader. Meso Scale Discovery 1250 Sector Imager 2400. Multimode Reader Comparison Chart. The SpectraMax® absorbance spectrophotometers and plate readers provide the versatility and convenience for a wide range of assays such as ELISAs, nucleic acid and protein quantitation, and microbial growth. The user must ensure that the meniscus is comfortably above the light beam in standard cuvettes and that the sample chamber in a microcuvette is aligned properly with the beam. 9 in. SpectraMax iD5; SpectraMax Mini; SpectraMax Mini Install Guide; SpectraMax Mini Reader Plug-In Download Page (required for SoftMax Pro 7. SpectraMax Plus384, 190, 340PC384, and VersaMax User Guide Molecular Devices User Guide SpectraMax Paradigm Microplate Reader General specifications User-upgradeable Multi-Mode Detection Platform Technical specifications Optimized Guaranteed* Fluorescence Intensity (FI) (Fluorescein) 96-well (200 µL) 0. When reading optical density at wavelengths below 340 nm, special UV-transparent, disposable or quartz microplates allowing transmission of the deep UV spectra must be used. 314 low lamp level warning. o SpectraMax M2 - Well Scan read mode - single well read coordinate problem fixed. The light transmittance was evaluated as function of wavelength of the BNC membranes. Typical applications for this powerful reader include DNA and RNA quantification. All data were generated from at least three independent experiments (n ≥ 3). The Molecular Devices SpectraMax® M5/M5e Microplate Reader was tested for compatibility with Life Technologies GeneBLAzer® assays. Corning® 384-well Flat Clear Bottom Black Polystyrene TC-treated Microplates, Low Flange, 20 per Bag, with Lid, Sterile Product Number 3764. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). It measures the optical density (OD) of samples in both 96- and 384-well. Key features 4 gain calibration failed. SpectraMax® M5e Multi-Mode Microplate Reader performance with an integrated 8- or 16-channel pipettor into one compact benchtop reader. Temperature range between 4°C above ambient to 45°C. SpectraMax and VersaMax Plate Readers Operator’s Manual — 0112-0126 Rev A SpectraMax Plus384 SpectraMax 190 SpectraMax 340PC384 VersaMax Microplate Spectrophotometer Operator's Manual Molecular Devices Corporation 1311 Orleans Drive Sunnyvale, California 94089 Part # 0112-0126 Rev A. It is upgradeable to include a barcode reader,. Item SpectraMax Plus 384 Microplate Spectrophotometer; Company Molecular Devices LLC; Catalog Number SpectraMax Plus 384; This product is no longer available on Biocompare. 滤光片型光吸收微孔板读板机(酶标仪),简单易用,性价比高,检测结果精确. Contains one microplate adapter, five 24-well low volume slides, five 64-well low volume bottom slides, and five of each cover slide (2 µL and 4 µL) 0200-6267. Molecular Devices SpectraMax i3 Multi-Mode Microplate Reader Pred i3x - AV $14,995. Enables data acquisition in endpoint, kinetic, and spectral scan modes at wavelengths across the UV-visible wavelength range, with the only temperature-independent method of pathlength correction. SPECTRAmax® PLUS384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. For more sample throughput, the system canTo provide access to disconnect power from the instrument, maintain a 20 cm to 30 cm (7. Special tubing set, Multidrop (length of tubing 50 - 200 cm in 10 cm increments) The minimum order for this item is . 313 reference gain check fail. On the front panel of the instrument, press the load/eject button to move the microplate drawer outside of the instrument. The dual monochromator optics allow the widest range of applications to be utilized for bioresearch and drug discovery applications, all without the need to change. 384 wells < 45 sec. Page 6 SpectraMax Plus384, 190, 340PC384, and VersaMax Installation Guide Connecting Instrument Cables The power cord and USB cable connect to the ports on the rear of the instrument. The eight-channel system delivers both high precision and speed when reading 96- and 384-well microplates for endpoint measurements, kinetic assays, and spectral scans. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. 997 (n = 3). This integrated system. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. Temperature control. The optical systems use two scanning monochromators soSpectramax Plus 384 Microplate Reader is available from The Lab World Group. 2. For more information, please visit us at SpectraMax® M2/M2e microplate readers for use with the Transcreener® FI Assays. to View Figures. 6-, 12-,. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. View the LabX ads below to find Molecular Devices SpectraMAX plate readers for sale and. The SpectraMax® Multi-Mode Microplate Reader provide great flexibility and include. Standard features include UV-visible absorbance in tunable 1,0 nm increments up to 4,0 nm, and fluorescence intensity with spectral scanning across the wavelength range in 1 nm increments and up to four wavelength pairs per protocol. Detection cartridge modularity allows for easy addition of new read modes within minutes without. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a. Note: Additional readers with similar performance are listed. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. Page 13: Introduction Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. !Pathchecklm1000. 0. 190-1000 nm, tunable in 1 nm increments. Fluorescence Intensity top and bottom capabilities. Tb donor/red acceptor. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Molecular Devices would like to introduce to you the SoftMax Pro 7, software designed to provide the simplicity, flexibility and power required for advanced. The manufacturer of Molecular Devices Spectramax Plus 384 Microplate UV/VIS Reader is Molecular Devices. 1. Monochromator wavelength selection saves you the time and trouble of ever having to change out filters. Standard features include a cuvette port, spectral scanning in 1 nm increments, and up to six wavelengths per read. TNF standard curve. SpectraMax ABS Plus SpectraTest ABS2 v1. If desired, the samples can be transferred into cuvettes before reading. The SpectraMax® ABS Plus Microplate Reader can run . The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. The SpectraMax M5e Reader offers the additional benefit of being certified for Cisbio Bioassays’ HTRF® Assays. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI). Reliable performance with a proven track record. Assay setup for a 384-well low-volume plate. 8 (W) x 15 (D)SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Fixed a problem in SpectraMax Gemini setup when switching to luminescence where range checking errors were reported incorrectly. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Products : SpectraMax M2/M2e reader, SpectraMax M5/M5e reader, Gemini XPS reader, SpectraMax Plus 384 reader, SpectraMax 190 reader, VersaMax reader, FlexStation 3 reader I need to reinstall the USB driver for my plate reader. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Set up SoftMax Pro Software to use PathCheck as detailed above. Simplified microplate washing from single-tube dispensing to washing full 96- and 384-well plates. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. Wavelength Selection. Model: SpectraMax PLUS 384. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. 384 distinct wells in a source plate to a read plate, simultaneously. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Check: In the data table create two new columns and add the following formulas: !Pathchecklm900. Published Dec 16, 2020 | Updated Dec 16, 2020. With the SpectraMax® MiniMax™ 300 Imaging Cytometer, industry-leading SoftMax® Pro Software, and user. Used MOLECULAR DEVICES SPECTRAmax 384 Spectrophotometer For Sale - DOTmed Listing #2356563: Spectra Max Plus 384 Microplate Spectrophotometer - GOOD WORKING UNIT Equipment was recently removed. no. 96 wells 384 wells Absorbance 0:30 1:40 Fluorescence intensity 0:25 1:25 Luminescence 0:30 1:15. Computer and software not available. Detection cartridge modularity allows for easy addition of new read modes within minutes without. Place the microplate on or remove it from the microplate drawer. Easy-to-use, robust assay kits for. ELISAs/EIAs. Table 2 summarizes the results for the uniformity test. PathCheck Sensor. flat meniscus), but is approx 15 mL. The SpectraMax i3x reader has variable bandwidth for fluorescence and luminescence, and you are able to choose either 9nm or 15 nm for excitation and either 15 nm or 25 nm for emission. The SpectraMax M5e Micoplate Reader is the standard for UV/Visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96-well and 384-well microplates. spr * SpectraMax i3(x) SpectraTest ABS2 v1. 2. 3) This warranty covers the SPECTRAmax PLUS 384MOLECULAR DEVICES SPECTRA max PLUS 384 Microplate Reader from Bid On Equipment. The narrow bandwidths used by the model increase measurement accuracy and linearity over a wide. Download PDF versions of the SpectraMax Microplate Reader User Guides. Biocompare is the leading resource for up-to. 7. With three modes of detection for full spectrum absorbance, fluorescence and luminescence, It is user upgradeable from 2 to 3 modes. SpectraMax® ABS Plus microplate reader can run both cuvette-based and microplate reader applications on the same instrument. . Title: SpectraMax i Series Multi-Mode Microplate Readers | Molecular Devices Author: Molecular Devices Subject: SpectraMax i Series offer the ideal solution for any application whether you are looking for an intuitive, easy-to-use reader, multi-user lab, or an upgradeable system that can adapt to support your lab s new projects. Features demonstrated by the model include temperature control, a robot-compatible interface and data analysis software. AlphaScreen assays cannot be done on the SpectraMax M series, Gemini, and SpectraMax iDx (iD3/iD5) readers. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. The SPECTRAmax™ 340PC 384 microplate spectrophotometer provides rapid and sensitive measurements of a variety of analytes across a wide range of concentrations. The SpectraMax ® Plus 384 Microplate Reader gives you walk-up convenience for both standard spectrophotometer and microplate reader applications on the. Page 19: Plate Adapter SpectraMax M2 and M2e Microplate Reader User Guide Plate Adapter Before you read standard 96-well or 384-well plates from the top, you must insert the plate adapter in the plate drawer. By measuring optical pathlength, it eliminates the last major distinction between microplate readers and spectrophotometers. Manufacturer: Molecular Devices Model: SpectraMax Will included PC workstation w/ preloaded softmax pro software Wavelength Range: 340 – 850 nm Wavelength Selection: Monochromator, tunable 1. The Molecular Devices SpectraMax M3 Multi-Mode Microplate Reader is a dual-monochromator, multi-detection microplate reader with full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well. 6 to 384-well plates, LVis Plate with sixteen 2 µL microspots; Get Quote. The Molecular Devices SpectraMax 384 is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and. 0. spr SpectraMax Plus 384. This white, polystyrene ProxiPlate&trade; has shallow wells allowing for lower volumes to be used in assays. SPECTRAmax PLUS 384 measuring instruments pdf manual download. ability to detect 16 ng/well of DNA and to quantitate 50 ng of . Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. SpectraMax iD3 reader with touchscreen and inserted USB flash drive. Optimal volumes are usually stated as 'working volume', which is 25 - 90 mL. The SpectraMax Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax 340PC384: SpectraMax Plus384: VERSAmax: Vmax: Tecan: Sunrise: Trinean: DropSense96: AMBIENT TEMPERATURE STORAGE: Liconic: LPX 220 Hotel: LPX 440 Hotel:. Enables data acquisition in endpoint, kinetic, and spectral scan modes at wavelengths across the UV-visible wavelength range, with the only temperature-independent method of pathlength correction. Flexible Throughput Read one sample or up to 384 at a time – it’s your choice. both cuvette-based and microplate reader applications on the same instrument. both cuvette-based and microplate reader applications on the same instrument. The reader adds up to three transfers of assay reagents from a 96- or 384-well source plate to enhance assay design using integrated fluidics. The SpectraMax ABS Plus Microplate Reader can run both cuvette-based and microplate based reader applications on the same instrument. Read one sample or up to 384 samples in a single plate by using any standard cuvette, or 96- or 384-well microplate. SpectraMax i3x Multi-Mode Microplate Reader. All measures were done in triplicate. Fluorescence Microplate Reader Comparison Chart. 00 USD BMG FLUOstar Omega Microplate Reader Unit2 - AV $10,295. Version7. 305 reference level saturation. used. Spectrophotometer 또는 Microplate Reader 상의 260nm에서 측정된 DNA 샘플의 흡광도는…. Thermo LTQ Orbitrap Velos LC/MS System. 0200-6262. For more sample throughput, the system can be. Wavelength(s): 230 to 750 nm (depending on model) Features: Shaking, Temperature Control. The SpectraMax® Glo Steady-Luc™ Reporter Assay Kit provides a highly sensitive assay for the quan-titation of firefly luciferase expression in mammalian cells. Three low volume 24-well bottom slides. Molecular Devices, LLC. Next generation SpectraMax® absorbance microplate readers. Features. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. To rule out any nonspecific binding, an irrelevant human Fc-fusion protein control was used to test the hybridoma supernatants. no. Vice President Sales and Marketing. ItThe SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. SpectraMax L Microplate Reader is a sensitive luminometer with programmable injector options that measures flash and glow luminescence assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) in 96- and 384-well plates. Time Resolved Fluorescence. The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. Molecular Devices Spectramax 384 Plus Microplate Reader. If using test tubes, read the absorbance of each tube in the cuvette port of the SPECTRAmax PLUS microplate spectrophotometer. The standard 8 filter modes enable endpoint and kinetic applications such as protein quantification, cell viability and ELISA. Using the patented PathCheck® Pathlength Measurement Technology, the SpectraMax M4 Microplate Reader transforms each well in a microplate to a fixed. 5 mP. Labsystems Nepheloskan Ascent Microplate Reader. SPECTRAmax® PLUS384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Products : General, Microplate Readers. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. The AlphaScreen Detection Cartridges utilize a 680nm Laser Diode to provide a sensitive reading system for AlphaScreen assays. This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. Qualify the absorbance performance of SpectraMax® iD3, iD5, i3, i3x, M2, M2e, M3, M4, M5, M5e, Plus 384, ABS, ABS Plus, and FlexStation 3 readers. GeneBLAzer® Compatible Microplate Reader Documentation. 0nm increments. BOE offers an extensive inventory of competitively priced Lab Equipment. , FI 45 sec. Operators can conveniently select up to six wavelengths at a time for absorbance detection in the visible wavelength range of 340 nm – 850 nm. Slide the tip into the nozzle, the slots are labeled 1 and 2 for injector 1 and injector 2. Molecular Devices Spectramax Plus 384 Microplate Reader is available from The Lab World Group. SpectraMax M5. Accurate quantitation TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytes acrossawiderangeofconcentrations. The SpectraTest ABS1 plate is a reliable and. SpectraMax ABS Plus reader utilizes Molecular Devices PathCheck Sensor- the only patented technology. It may be named "Pothos". Validating the absorbance optical performance of your microplate reader is as simple as reading a plate. Categories:. SpectraMax Gemini XPS/EM Register or Sign In. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. General-purpose refrigerators are ideal economical units for when precise temperature control and maintenance are not. Capabilities include fluorescence and luminescence readings, environmental control, cell viability assays, enzyme. 384 wells) and the "Select Specific" menu to choose the specific plate type. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. 312 gain calibration failed. spectramax id3 multi-mode microplate reader, spectramax id3, softmax pro 7 software, spectramax id3 injector system. . The SpectraMax® Gemini™ XPS Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. Technical specifications Detection limit for ATP Glow 0200-7012 (LUM) Optimized Guaranteed* 96-well (200 µL) 1. Manufacturer: Molecular Devices; Model: SpectraMax; Will included PC workstation w/ preloaded softmax pro software Wavelength Range: 340 – 850 nm Wavelength Selection: Monochromator, tunable 1. Published Dec 16, 2020 | Updated Dec 16, 2020. We have a great online selection at the lowest prices with Fast & Free shipping on many items!384-well (75 µL) 0. Molecular Devices Spectramax. A microplate reader that can detect two or more applications is considered a multi-mode plate reader. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax® 340PC384 microplate reader provides everything needed to measure absorbance in the visible range, including temperature control, a robotics-compatible interface and SoftMax® Pro data analysis software. Detection Cartridge (384) (PN 0200-7015) • SpectraMax Paradigm Glow Luminescence (LUM) Detection Cartridge (96) (PN 0200-7014) A glow luminescence detection cartridge contains the optics and electrical components needed to perform specific measurement modes or for specific applications. Minimum volume and maximum throughput with 96- or 384. It measures the optical density (OD) of samples in both 96- and 384-well microplates or in a cuvette at a selected wavelength for a single point in time (endpoint), over a specified period of time (kinetic), or over a selected. Double-click the unknown device with the yellow warning icon. SpectraMax340PC384reads96-wellplatesand384-wellplates. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Temperature control. SpectraMax® M2 and M2e Microplate Readers are the standard for UV/visible multimode reader absorbance, providing ultrafast and full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Regularly used for NADPH ATPase assays, and BCA assays. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time. Spectral Range. spr SpectraMax iD5 SpectraTest ABS2 v1. 2 5. , FI 45 sec. Regularly used for NADPH ATPase assays, and BCA assays. Or scan up to 384 wells at any time to. Includes: Computer Loaded with SoftMax Pro 5. 0 fluorometer; BioMicroLab – XL20 tube sorter; Biobus; Thermo Scientific – NanoDrop 2000 Spectrophotometer; Thermofisher – Qubit FluorometerSpectraMax® L和SpectraMax® M5酶标仪均为CellTiter-Glo检测提供了优异的检测灵敏度。SpectraMax® L化学发光读板机带有自动增益功能,能同时进行模拟信号和光子计数,提供大于9个数量级的动态范围,对于高信号值样品无需稀释,同时对于低信号样品具有优越的灵敏度。After 3× washing, the plates were developed with ABTS substrate (Moss) and analyzed on a SpectraMax Plus 384 spectrophotometer (Molecular Devices) at optical density (OD) 405 nm. Validate the optical performance of your absorbance . Check Details. Learn more about its features, specifications, and applications in this user. Top or bottom detection is available at the touch of a button. microplates or in a cuvette at a. 1. Eight different automated tests are provided: • Absorbance accuracy (linearity) • Precision (reproducibility) • Stray light • Wavelength accuracy • Wavelength repeatabilityThe SpectraMax® ABS Plus Microplate Reader can run both cuvette-based and microplate reader applications on the same instrument. Manufacturer: Molecular Devices Model: SpectraMax Plus 384 The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. TheSpectraMax®Plus384addstheabilitytoread cuvettes. The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. Temperature control and shaking come standard. The SoftMax® Pro Data Acquisition and Analysis Software controls Molecular Devices® spectrophotometers and absorbance, luminescence, and fluorescence microplate readers andThe absorbance at 450 nm was measured with a microplate reader (SPECTRAmax 384, Molecular Devices, United States). Simply select the absorbance maximum of a sample and let the monochromator tune to that exact wavelength. You manually lift up the lid over the chamber to insert or remove a cuvette. All have an optical pathlength of 1 cm (10 mm) and standard external dimensions (12. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. SpectraMax340PC384reads96-wellplatesand384-wellplates. Description: The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research. SpectraMax ® Plus 384 optics. TheSpectraMax®Plus384addstheabilitytoreadcuvettes. 96- or 384-well microplate compatibility. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. We would like to show you a description here but the site won’t allow us. Keywords: fluorescence polarization. Also refer to this Multimode Reader Comparison Chart. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. Create custom fluorescence assays without having to purchase expensive filter sets. SpectraMax M2e Plate Reader; Application: Absorbance Concentration of Nucleic Acid: Fluorescence Concentration of RNA or DNA: Absorbance, Florescence, Luminescence RNA, DNA, Proteins: Range: 10ng-3000 ng (Accuracy diminishes less than 20 ng/µl and above 1500 ng/µl) RNA Broad Range: 20-1000 ng RNA: 5-100 ng DNA Broad Range: 2. spectramax, i3x, spectramax i3x, detection cartridge, spectramax i3x injector cartridge, smartinject technology, atp a, spectramax i3x multi-mode microplate reader, luminescent cell. For more sample throughput, both readers can be easily SpectraMax i3x Microplate Reader, Molecular Devices (Cat# i3X) 96-well white walled clear bottom plates, Costar (Cat# 3903) Purified luciferase, Promega (Cat# E1701) 384-well solid white plates, Greiner (Cat# 655075) CHO-K1 cells, ATCC (Cat# CCL-61) Complete Growth Media Ham’s F12 Medium, Life Technologies (Cat# 11765-54) SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. Get more information about Fluorescence Polarization SpectraMax Detection Cartridges, which offer great sensitivity for SpectraMax i3x and Paradigm Systems. Page 12 Chapter 1 SpectraMax GEMINI EM Operator’s Manual. 303 unable to cal dark current. The SpectraMax® Plus 384 adds the ability to read cuvettes. Review date: 12 Jun 2017 | SpectraMax Plus 384 Microplate Reader Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. The technology allows automatic adjustment of good absorbance to a tube equivalent path length of 1 cm, converted to 96 or 384 tubes. Multimode Readers Comparison Chart. The adapter isThe SpectraMax Paradigm Multi Mode Detection Platform utilizes a patent pending design that allows for real time system configuration by the user in less than two minutes. For 40 years, we have partnered with scientists to help them achieve landmark discoveries. The narrow bandwidths used by the model increase measurement accuracy and linearity over a wide range. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Shaker time: 0 to 999 seconds Temperature control: Ambient +4°C to 45°C Temperature. The top- and bottom-reading Gemini EM Microplate Reader with dual monochromators lets users determine the optimal excitation and emission settings for creative new fluorescence. Regularly used for NADPH ATPase assays, and BCA assays. Narrow bandwidths deliver increased measurement accuracy and linearity over the widest range of assays, including. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. 314 low lamp level warning. Read one sample or up to 384 at a time – it’s your choice. 030 fmol Fluorescence Polarization (FP) (Fluorescein 1 nM, SD) 96-well (200 µL) 0. Results were presented as mean ± standard deviation. Sold as-is. Top detection is available for fluorescence detection on the SpectraMax M2, while top and bottom reads are possible on the SpectraMax M2 . Published Dec 16, 2020 | Updated Dec 16, 2020. The EMax® Plus Microplate Reader is designed to be a versatile and robust plate reader for research laboratories. For more sample throughput, the system canMicroplate Spectrophotometers. Product Specs; Item SpectraMax Plus 384 Spectrophotometer; Company Molecular Devices LLC; This product is no longer available on Biocompare. The LMax plate reader has similar calculations and its RLUs are comparable to those of LMax II 384. As a generous estimate, you might consider 300 W (at 120 Volts) per Spectramax reader, plus another 300 W for the Computer. View the Molecular Devices website. When reading optical density at wavelengths below 340 nm, special UVtransparent, disposableFor SpectraMax ABS Plus reader, r 2 = 0. SpectraDrop Micro-Volume Refills, 24-Well Bottom Slides. 0nm incrementsThe SPECTRAmax™ plus 384 microplate spectrophotometer provides rapid UV/VIS measurements of a variety of analytes. Detection modalities are shown in Table 1-1. The SpectraMax Paradigm Platform was able to quantify the protein down to the low picomolar level using an AlphaLISA method (Figure 1). With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. Hybrid optical system on the SpectraMax iD5 reader. By utilizing the optimized instrument settings suggested within this Application Note, Z' values > 0. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. 2. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. 384-well microplate for use in time-resolved fluorescence, luminescence, Alpha, and radiometric assays. Colorimetric assays. It measures the optical density (OD) of samples in both 96- and 384-well. SpectraMax Paradigm Microplate Reader General specifications User-upgradeable Multi-Mode Detection Platform Technical specifications Optimized Guaranteed* Fluorescence Intensity (FI) (Fluorescein) 96-well (200 µL) 0. We would like to show you a description here but the site won’t allow us. The SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. The SpectraMax® Glo Steady-Luc™ Reporter Assay Kit provides a highly sensitive assay for the quan-titation of firefly luciferase expression in mammalian cells. Explore how the SpectraMax i3 Multi-Mode Platform provides an unlimited breadth of application possibilities, and how it can evolve with your future needs. Capture flash assays with ease Expand your lab’s capabilities to include flash applications such as dual luciferase and ATP assays with the SpectraMax iD3 injector system with SmartInject™ Technology ensuring equal mixingThe SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Fluorescent Polarization: Solid black plates, as above. No accessories are needed and SoftMax® Pro Software. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a variety of assays. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 10822 512. spr SpectraMax M2 M2e M3 M4 M5 M5e SpectraTest ABS2 v1. Microplate Spectrophotometer. Description Control Panel Cuvette Chamber Back Panel Microplate Drawer The Control Panel TEMP on/off TEMP Figure 1. SpectraMax i3x. There were 12 replicate wells per dilution in both 96-well and 384- well plates. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. Time Resolved Fluorescence: Solid white plates for top reads and white plates with clear bottoms for bottom reads. </p> <p>Tissue-culture treated microplates are supplied with lids except when supplied in a case of 200 microplates. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Users can password-protect data, choose from nine different curve-fitting routines and use default data reduction, or set up custom formulas for analysis. Compact design. No accessories are needed and SoftMax® Pro Software. A microplate reader as The SpectraMax® i3x Multi-Mode Microplate Reader measures absorbance, fluorescence, and luminescence with available upgrades including western blot, cell imaging, and fast kinetics with injectors plus additional detection modes.